3.18 Rating by CuteStat

nononsensefatmeltingsystemreview.com is 7 years 2 weeks old. It is a domain having com extension. This website is estimated worth of $ 8.95 and have a daily income of around $ 0.15. As no active threats were reported recently by users, nononsensefatmeltingsystemreview.com is SAFE to browse.

PageSpeed Score
91
Siteadvisor Rating
Not Applicable

Traffic Report

Daily Unique Visitors: Not Applicable
Daily Pageviews: Not Applicable

Estimated Valuation

Income Per Day: $ 0.15
Estimated Worth: $ 8.95

Search Engine Indexes

Google Indexed Pages: Not Applicable
Bing Indexed Pages: Not Applicable

Search Engine Backlinks

Google Backlinks: Not Applicable
Bing Backlinks: Not Applicable

Safety Information

Google Safe Browsing: No Risk Issues
Siteadvisor Rating: Not Applicable
WOT Trustworthiness: Not Applicable
WOT Child Safety: Not Applicable

Website Ranks & Scores

Alexa Rank: Not Applicable
Domain Authority: Not Applicable

Web Server Information

Hosted IP Address:

149.202.201.228

Hosted Country:

France FR

Location Latitude:

50.5821

Location Longitude:

2.7071
No Nonsense Fat Melting System Review – here

Page Resources Breakdown

Homepage Links Analysis

Website Inpage Analysis

H1 Headings: 2 H2 Headings: 1
H3 Headings: Not Applicable H4 Headings: Not Applicable
H5 Headings: Not Applicable H6 Headings: Not Applicable
Total IFRAMEs: Not Applicable Total Images: Not Applicable
Google Adsense: Not Applicable Google Analytics: Not Applicable

Websites Hosted on Same IP (i.e. 149.202.201.228)

403 Forbidden

- alsaleemi.net
Not Applicable $ 8.95

403 Forbidden

- tamizgift.com
Not Applicable $ 8.95

How To Stop Restless Legs

- howtostoprestlesslegs.com

If you are wondering how to stop restless legs then remember that there are some amazing natural cures for this condition.

19,990,524 $ 8.95

Fat Diminisher system review

- fatdiminisherpdfreview.com
Not Applicable $ 8.95

Avalon Bay portable ice maker review | Read Honest review of Ice Maker

- avalonbayportableicemakerreview.com

Summertime is here. Lovely beaches, parties, backyard barbecues, and outdoor camping are only to name a few of the exciting activities to look forward to.

Not Applicable $ 8.95

HTTP Header Analysis

HTTP/1.1 200 OK
Server: nginx
Date: Sun, 11 Jun 2017 10:09:56 GMT
Content-Type: text/html; charset=UTF-8
Transfer-Encoding: chunked
Connection: keep-alive
Vary: Accept-Encoding
Link: <http://www.nononsensefatmeltingsystemreview.com/wp-json/>; rel="https://api.w.org/"
X-Cache: HIT from Backend
Content-Encoding: gzip

Domain Information

Domain Registrar: GoDaddy.com, LLC
Registration Date: May 28, 2017, 12:00 AM 7 years 2 weeks 4 days ago
Last Modified: Jun 9, 2017, 12:00 AM 7 years 6 days 18 hours ago
Expiration Date: May 28, 2018, 12:00 AM 6 years 2 weeks 3 days ago
Domain Status:
clientDeleteProhibited
clientRenewProhibited
clientTransferProhibited
clientUpdateProhibited

Domain Nameserver Information

Host IP Address Country
ns1.neklawy.com 46.4.222.108 Germany Germany
ns2.neklawy.com 46.4.222.109 Germany Germany

DNS Record Analysis

Host Type TTL Extra
nononsensefatmeltingsystemreview.com A 14382 IP: 149.202.201.228
nononsensefatmeltingsystemreview.com NS 86399 Target: ns1.neklawy.com
nononsensefatmeltingsystemreview.com NS 86399 Target: ns2.neklawy.com
nononsensefatmeltingsystemreview.com SOA 86399 MNAME: ns1.neklawy.com
RNAME: saheemnet.hotmail.com
Serial: 2017061002
Refresh: 3600
Retry: 7200
Expire: 1209600
Minimum TTL: 86400
nononsensefatmeltingsystemreview.com MX 14399 Target: nononsensefatmeltingsystemreview.com
nononsensefatmeltingsystemreview.com TXT 14399 TXT: v=spf1 +a +mx +ip4:149.202.201.228 ~all

Full WHOIS Lookup

Domain Name: nononsensefatmeltingsystemreview.com
Registrar URL: http://www.godaddy.com
Registrant Name: Saheem Abdullah Ramadan Al kindi
Registrant Organization:
Name Server: NS1.NEKLAWY.COM
Name Server: NS2.NEKLAWY.COM
DNSSEC: unsigned

For complete domain details go to:
http://who.godaddy.com/whoischeck.aspx?domain=nononsensefatmeltingsystemreview.com

The data contained in GoDaddy.com, LLC's WhoIs database,
while believed by the company to be reliable, is provided "as is"
with no guarantee or warranties regarding its accuracy. This
information is provided for the sole purpose of assisting you
in obtaining information about domain name registration records.
Any use of this data for any other purpose is expressly forbidden without the prior written
permission of GoDaddy.com, LLC. By submitting an inquiry,
you agree to these terms of usage and limitations of warranty. In particular,
you agree not to use this data to allow, enable, or otherwise make possible,
dissemination or collection of this data, in part or in its entirety, for any
purpose, such as the transmission of unsolicited advertising and
and solicitations of any kind, including spam. You further agree
not to use this data to enable high volume, automated or robotic electronic
processes designed to collect or compile this data for any purpose,
including mining this data for your own personal or commercial purposes.

Please note: the registrant of the domain name is specified
in the "registrant" section. In most cases, GoDaddy.com, LLC
is not the registrant of domain names listed in this database.