Web Analysis for Nononsensefatmeltingsystemreview - nononsensefatmeltingsystemreview.com
nononsensefatmeltingsystemreview.com is 7 years 2 weeks old. It is a domain having com extension. This website is estimated worth of $ 8.95 and have a daily income of around $ 0.15. As no active threats were reported recently by users, nononsensefatmeltingsystemreview.com is SAFE to browse.
PageSpeed Score
Siteadvisor Rating
Traffic Report
Daily Unique Visitors: | Not Applicable |
Daily Pageviews: | Not Applicable |
Estimated Valuation
Income Per Day: | $ 0.15 |
Estimated Worth: | $ 8.95 |
Search Engine Indexes
Google Indexed Pages: | Not Applicable |
Bing Indexed Pages: | Not Applicable |
Search Engine Backlinks
Google Backlinks: | Not Applicable |
Bing Backlinks: | Not Applicable |
Safety Information
Google Safe Browsing: | No Risk Issues |
Siteadvisor Rating: | Not Applicable |
WOT Trustworthiness: | Not Applicable |
WOT Child Safety: | Not Applicable |
Website Ranks & Scores
Alexa Rank: | Not Applicable |
Domain Authority: | Not Applicable |
Web Server Information
Page Resources Breakdown
Homepage Links Analysis
Website Inpage Analysis
H1 Headings: | 2 | H2 Headings: | 1 |
H3 Headings: | Not Applicable | H4 Headings: | Not Applicable |
H5 Headings: | Not Applicable | H6 Headings: | Not Applicable |
Total IFRAMEs: | Not Applicable | Total Images: | Not Applicable |
Google Adsense: | Not Applicable | Google Analytics: | Not Applicable |
Websites Hosted on Same IP (i.e. 149.202.201.228)
How To Stop Restless Legs
If you are wondering how to stop restless legs then remember that there are some amazing natural cures for this condition.
Avalon Bay portable ice maker review | Read Honest review of Ice Maker
Summertime is here. Lovely beaches, parties, backyard barbecues, and outdoor camping are only to name a few of the exciting activities to look forward to.
HTTP Header Analysis
Server: nginx
Date: Sun, 11 Jun 2017 10:09:56 GMT
Content-Type: text/html; charset=UTF-8
Transfer-Encoding: chunked
Connection: keep-alive
Vary: Accept-Encoding
Link: <http://www.nononsensefatmeltingsystemreview.com/wp-json/>; rel="https://api.w.org/"
X-Cache: HIT from Backend
Content-Encoding: gzip
Domain Information
Domain Nameserver Information
DNS Record Analysis
Host | Type | TTL | Extra |
---|---|---|---|
nononsensefatmeltingsystemreview.com | A | 14382 |
IP: 149.202.201.228 |
nononsensefatmeltingsystemreview.com | NS | 86399 |
Target: ns1.neklawy.com |
nononsensefatmeltingsystemreview.com | NS | 86399 |
Target: ns2.neklawy.com |
nononsensefatmeltingsystemreview.com | SOA | 86399 |
MNAME: ns1.neklawy.com RNAME: saheemnet.hotmail.com Serial: 2017061002 Refresh: 3600 Retry: 7200 Expire: 1209600 Minimum TTL: 86400 |
nononsensefatmeltingsystemreview.com | MX | 14399 |
Target: nononsensefatmeltingsystemreview.com |
nononsensefatmeltingsystemreview.com | TXT | 14399 |
TXT: v=spf1 +a +mx +ip4:149.202.201.228 ~all |
Full WHOIS Lookup
Registrar URL: http://www.godaddy.com
Registrant Name: Saheem Abdullah Ramadan Al kindi
Registrant Organization:
Name Server: NS1.NEKLAWY.COM
Name Server: NS2.NEKLAWY.COM
DNSSEC: unsigned
For complete domain details go to:
http://who.godaddy.com/whoischeck.aspx?domain=nononsensefatmeltingsystemreview.com
The data contained in GoDaddy.com, LLC's WhoIs database,
while believed by the company to be reliable, is provided "as is"
with no guarantee or warranties regarding its accuracy. This
information is provided for the sole purpose of assisting you
in obtaining information about domain name registration records.
Any use of this data for any other purpose is expressly forbidden without the prior written
permission of GoDaddy.com, LLC. By submitting an inquiry,
you agree to these terms of usage and limitations of warranty. In particular,
you agree not to use this data to allow, enable, or otherwise make possible,
dissemination or collection of this data, in part or in its entirety, for any
purpose, such as the transmission of unsolicited advertising and
and solicitations of any kind, including spam. You further agree
not to use this data to enable high volume, automated or robotic electronic
processes designed to collect or compile this data for any purpose,
including mining this data for your own personal or commercial purposes.
Please note: the registrant of the domain name is specified
in the "registrant" section. In most cases, GoDaddy.com, LLC
is not the registrant of domain names listed in this database.